Recombinant Human AGRP protein, His-tagged
Cat.No. : | AGRP-2464H |
Product Overview : | Recombinant Human AGRP protein(20-132 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-132 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT |
Gene Name | AGRP agouti related protein homolog (mouse) [ Homo sapiens ] |
Official Symbol | AGRP |
Synonyms | AGRP; agouti related protein homolog (mouse); agouti (mouse) related protein; agouti-related protein; Agrt; ART; ASIP2; AGRT; |
Gene ID | 181 |
mRNA Refseq | NM_001138 |
Protein Refseq | NP_001129 |
MIM | 602311 |
UniProt ID | O00253 |
◆ Recombinant Proteins | ||
AGRP-891H | Active Recombinant Human AGRP Protein, His-tagged | +Inquiry |
AGRP-3104C | Recombinant Chicken AGRP | +Inquiry |
AGRP-0446H | Recombinant Human AGRP Protein (Ala21-Thr132), N-His-tagged | +Inquiry |
AGRP -63H | Active Recombinant Human Agouti Related Protein | +Inquiry |
AGRP-3246H | Recombinant Human AGRP protein(Ser85-Thr132), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGRP-2471HCL | Recombinant Human AGRP cell lysate | +Inquiry |
AGRP-1142MCL | Recombinant Mouse AGRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGRP Products
Required fields are marked with *
My Review for All AGRP Products
Required fields are marked with *