Recombinant Human AGRP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AGRP-5468H
Product Overview : AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity.
Molecular Mass : 14.4 kDa
AA Sequence : MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AGRP agouti related neuropeptide [ Homo sapiens (human) ]
Official Symbol AGRP
Synonyms AGRP; agouti related protein homolog (mouse); agouti (mouse) related protein; agouti-related protein; Agrt; ART; ASIP2; AGRT;
Gene ID 181
mRNA Refseq NM_001138
Protein Refseq NP_001129
MIM 602311
UniProt ID O00253

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGRP Products

Required fields are marked with *

My Review for All AGRP Products

Required fields are marked with *

0
cart-icon
0
compare icon