Recombinant Human AGRP Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | AGRP-5468H |
| Product Overview : | AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. |
| Molecular Mass : | 14.4 kDa |
| AA Sequence : | MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | AGRP agouti related neuropeptide [ Homo sapiens (human) ] |
| Official Symbol | AGRP |
| Synonyms | AGRP; agouti related protein homolog (mouse); agouti (mouse) related protein; agouti-related protein; Agrt; ART; ASIP2; AGRT; |
| Gene ID | 181 |
| mRNA Refseq | NM_001138 |
| Protein Refseq | NP_001129 |
| MIM | 602311 |
| UniProt ID | O00253 |
| ◆ Recombinant Proteins | ||
| AGRP-814M | Recombinant Mouse AGRP Protein (Ser82-Thr131), HlgG1 Fc-tagged | +Inquiry |
| AGRP-311H | Recombinant Human AGRP Protein (21-132 aa), His-SUMO-tagged | +Inquiry |
| AGRP-94H | Recombinant Human AGRP Protein, His-tagged | +Inquiry |
| Agrp-546M | Active Recombinant Mouse Agouti Related Protein | +Inquiry |
| AGRP-891H | Active Recombinant Human AGRP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGRP-1142MCL | Recombinant Mouse AGRP cell lysate | +Inquiry |
| AGRP-2471HCL | Recombinant Human AGRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGRP Products
Required fields are marked with *
My Review for All AGRP Products
Required fields are marked with *



