Recombinant Human AGRP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AGRP-5468H |
Product Overview : | AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. |
Molecular Mass : | 14.4 kDa |
AA Sequence : | MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AGRP agouti related neuropeptide [ Homo sapiens (human) ] |
Official Symbol | AGRP |
Synonyms | AGRP; agouti related protein homolog (mouse); agouti (mouse) related protein; agouti-related protein; Agrt; ART; ASIP2; AGRT; |
Gene ID | 181 |
mRNA Refseq | NM_001138 |
Protein Refseq | NP_001129 |
MIM | 602311 |
UniProt ID | O00253 |
◆ Recombinant Proteins | ||
AGRP-814M | Recombinant Mouse AGRP Protein (Ser82-Thr131), HlgG1 Fc-tagged | +Inquiry |
AGRP-136H | Recombinant Human Agouti Related Protein Homolog (Mouse), His-tagged | +Inquiry |
AGRP-1206R | Recombinant Rhesus AGRP protein(Ser83-Thr132), mFc-tagged | +Inquiry |
AGRP-535H | Recombinant Human AGRP Protein, MYC/DDK-tagged | +Inquiry |
AGRP-0446H | Recombinant Human AGRP Protein (Ala21-Thr132), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGRP-2471HCL | Recombinant Human AGRP cell lysate | +Inquiry |
AGRP-1142MCL | Recombinant Mouse AGRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGRP Products
Required fields are marked with *
My Review for All AGRP Products
Required fields are marked with *