Recombinant Human AGTR1 protein, His&Myc-tagged

• Cat.No.: AGTR1-784H
• Product Overview: Recombinant Human AGTR1 protein(P30556)(297-359aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 297-359a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

Gene Information

• Gene Name: AGTR1 angiotensin II receptor, type 1 [ Homo sapiens ]
• Official Symbol: AGTR1
• Synonyms: AGTR1; angiotensin II receptor, type 1; AGTR1B, angiotensin receptor 1B; type-1 angiotensin II receptor; AG2S; AGTR1A; AT1; AT1B; AT2R1; AT2R1A; AT2R1B; HAT1R; AT1AR; AT1BR; angiotensin receptor 1; angiotensin receptor 1B; angiotensin II type-1 receptor; type-1B angiotensin II receptor; AT1R; AGTR1B
• Gene ID: 185
• mRNA Refseq: NM_000685
• Protein Refseq: NP_000676
• MIM: 106165
• UniProt ID: P30556