Recombinant Human AGTR1 Protein (297-359 aa), His-tagged

• Cat.No.: AGTR1-1320H
• Product Overview: Recombinant Human AGTR1 Protein (297-359 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 297-359 aa
• Description: Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 9.2 kDa
• AA Sequence: LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: AGTR1 angiotensin II receptor, type 1 [ Homo sapiens ]
• Official Symbol: AGTR1
• Synonyms: AGTR1; AG2S; AGTR1A; AT1; AT1B; AT2R1; AT2R1A; AT2R1B; HAT1R; AT1AR; AT1BR; AT1R; AGTR1B
• Gene ID: 185
• mRNA Refseq: NM_000685
• Protein Refseq: NP_000676
• MIM: 106165
• UniProt ID: P30556