Recombinant Human AHCYL2 protein, His-tagged
Cat.No. : | AHCYL2-9492H |
Product Overview : | Recombinant Human AHCYL2 protein(1-115 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-115 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEA |
Gene Name | AHCYL2 adenosylhomocysteinase-like 2 [ Homo sapiens ] |
Official Symbol | AHCYL2 |
Synonyms | AHCYL2; adenosylhomocysteinase-like 2; S adenosylhomocysteine hydrolase like 2; putative adenosylhomocysteinase 3; KIAA0828; S-adenosyl-L-homocysteine hydrolase 3; S-adenosylhomocysteine hydrolase-like 2; ADOHCYASE3; FLJ21719; |
Gene ID | 23382 |
mRNA Refseq | NM_001130720 |
Protein Refseq | NP_001124192 |
UniProt ID | Q96HN2 |
◆ Recombinant Proteins | ||
AHCYL2-9492H | Recombinant Human AHCYL2 protein, His-tagged | +Inquiry |
AHCYL2-11485Z | Recombinant Zebrafish AHCYL2 | +Inquiry |
AHCYL2-296H | Recombinant Human AHCYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AHCYL2-311H | Recombinant Human AHCYL2 Protein, MYC/DDK-tagged | +Inquiry |
AHCYL2-5643H | Recombinant Human AHCYL2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHCYL2 Products
Required fields are marked with *
My Review for All AHCYL2 Products
Required fields are marked with *
0
Inquiry Basket