Recombinant Human AHDC1 Protein, GST-tagged

Cat.No. : AHCYL1-457H
Product Overview : Human AHCYL1 partial ORF ( NP_006612, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene interacts with inositol 1,4,5-trisphosphate receptor, type 1 and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
Molecular Mass : 36.85 kDa
AA Sequence : MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AHCYL1 adenosylhomocysteinase-like 1 [ Homo sapiens ]
Official Symbol AHCYL1
Synonyms AHCYL1; adenosylhomocysteinase-like 1; S adenosylhomocysteine hydrolase like 1; putative adenosylhomocysteinase 2; inositol 1; 4; 5 trisphosphate receptor binding protein; IRBIT; XPVKONA; adoHcyase 2; DC-expressed AHCY-like molecule; S-adenosyl-L-homocysteine hydrolase 2; S-adenosyl homocysteine hydrolase homolog; dendritic cell expressed AHCY-like protein; S-adenosylhomocysteine hydrolase-like protein 1; inositol 1,4,5-trisphosphate receptor-binding protein; DCAL; PRO0233;
Gene ID 10768
mRNA Refseq NM_001242673
Protein Refseq NP_001229602
MIM 607826
UniProt ID O43865

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHCYL1 Products

Required fields are marked with *

My Review for All AHCYL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon