Recombinant Human AHDC1 Protein, GST-tagged

Cat.No. : AHDC1-458H
Product Overview : Human AHDC1 full-length ORF ( AAH14394.2, 1 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing two AT-hooks, which likely function in DNA binding. Mutations in this gene were found in individuals with Xia-Gibbs syndrome. [provided by RefSeq, Jun 2014]
Molecular Mass : 68.1 kDa
AA Sequence : MMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRSTGPRQPRGGRGGGACSAKKERGGAAAKAKFIPKPQPVNPLFQDSPDLGLDYYSGDSSMSPLPSQSRAFGVGERDPCDFIGPYSMNPSTPSDGTFGQGFHCDSPSLGAPELDGKHFPPLAHPPTVFDAGLQKAYSPTCSPTLGFKEELRPPPTKLAACEPLKHGLQGASLGHAAAAQAHLSCRDLPLGQPHYDSPSCKGTAYWYPPGSAARSPPYEGKVGTGLLADFLGRTEAACLSAPHLASPPATPKADKEPLEMARPPGPPRGPAAAAAGYGCPLLSDLTLSPVPRDSLLPLQDTAYRYPGFMPQAHPGLGGGPKSGFLGPMAEPHPEDTFTVTSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AHDC1 AT-hook DNA binding motif containing 1 [ Homo sapiens (human) ]
Official Symbol AHDC1
Synonyms AHDC1; AT-hook DNA binding motif containing 1; AT-hook DNA-binding motif-containing protein 1; AT-Hook DNA-Binding Motif-Containing Protein 1; AT Hook, DNA Binding Motif, Containing 1; MRD25
Gene ID 27245
mRNA Refseq NM_001029882
Protein Refseq NP_001025053
MIM 615790
UniProt ID Q5TGY3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHDC1 Products

Required fields are marked with *

My Review for All AHDC1 Products

Required fields are marked with *

0
cart-icon