Recombinant Human AHSA2 protein, His-tagged
Cat.No. : | AHSA2-5854H |
Product Overview : | Recombinant Human AHSA2 protein(163-295 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 163-295 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLT |
Gene Name | AHSA2 AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) [ Homo sapiens ] |
Official Symbol | AHSA2 |
Synonyms | AHSA2; AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast); activator of 90 kDa heat shock protein ATPase homolog 2; DKFZp564C236; Hch1; FLJ34679; FLJ41715; |
Gene ID | 130872 |
mRNA Refseq | NM_152392 |
Protein Refseq | NP_689605 |
UniProt ID | Q719I0 |
◆ Recombinant Proteins | ||
AHSA2-1445M | Recombinant Mouse AHSA2 Protein | +Inquiry |
AHSA2-407M | Recombinant Mouse AHSA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AHSA2-951HF | Recombinant Full Length Human AHSA2 Protein, GST-tagged | +Inquiry |
AHSA2-4291C | Recombinant Chicken AHSA2 | +Inquiry |
AHSA2-468H | Recombinant Human AHSA2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSA2-8960HCL | Recombinant Human AHSA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHSA2 Products
Required fields are marked with *
My Review for All AHSA2 Products
Required fields are marked with *
0
Inquiry Basket