Recombinant Human AHSG Protein, GST-tagged
Cat.No. : | AHSG-470H |
Product Overview : | Human AHSG full-length ORF ( AAH48198.1, 19 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 64.13 kDa |
AA Sequence : | APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AHSG alpha-2-HS-glycoprotein [ Homo sapiens ] |
Official Symbol | AHSG |
Synonyms | AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS; |
Gene ID | 197 |
mRNA Refseq | NM_001622 |
Protein Refseq | NP_001613 |
MIM | 138680 |
UniProt ID | P02765 |
◆ Recombinant Proteins | ||
AHSG-446HFL | Recombinant Full Length Human AHSG Protein, C-Flag-tagged | +Inquiry |
AHSG-816H | Recombinant Human AHSG Protein | +Inquiry |
Ahsg-167M | Recombinant Mouse Ahsg Protein, His-tagged | +Inquiry |
AHSG-101C | Recombinant Cattle AHSG Protein, His-tagged | +Inquiry |
AHSG-565H | Recombinant Human alpha-2-HS-glycoprotein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *