Recombinant Human AHSG protein, T7/His-tagged

Cat.No. : AHSG-202H
Product Overview : Recombinant human AHSG (19-367 aa, derived from BC048198) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 19-367 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT .
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQID EVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSA EDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEAT EAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLP PAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRH FKV
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro AHSG mediated cell differentiation / activation regulation study with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping AHSG protein-protein interaction.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. Potential biomarker protein for early diagnosis of Rheumatoid Arthritis, Hypothyroidism et al.5. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name AHSG alpha-2-HS-glycoprotein [ Homo sapiens ]
Official Symbol AHSG
Synonyms AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS;
Gene ID 197
mRNA Refseq NM_001622
Protein Refseq NP_001613
MIM 138680
UniProt ID P02765
Chromosome Location 3q27.3
Pathway BMP receptor signaling, organism-specific biosystem;
Function cysteine-type endopeptidase inhibitor activity; kinase inhibitor activity; receptor signaling protein tyrosine kinase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHSG Products

Required fields are marked with *

My Review for All AHSG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon