Recombinant Human AHSG protein, T7/His-tagged
Cat.No. : | AHSG-202H |
Product Overview : | Recombinant human AHSG (19-367 aa, derived from BC048198) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 19-367 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT . |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQID EVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSA EDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEAT EAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLP PAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRH FKV |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro AHSG mediated cell differentiation / activation regulation study with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping AHSG protein-protein interaction.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. Potential biomarker protein for early diagnosis of Rheumatoid Arthritis, Hypothyroidism et al.5. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | AHSG alpha-2-HS-glycoprotein [ Homo sapiens ] |
Official Symbol | AHSG |
Synonyms | AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS; |
Gene ID | 197 |
mRNA Refseq | NM_001622 |
Protein Refseq | NP_001613 |
MIM | 138680 |
UniProt ID | P02765 |
Chromosome Location | 3q27.3 |
Pathway | BMP receptor signaling, organism-specific biosystem; |
Function | cysteine-type endopeptidase inhibitor activity; kinase inhibitor activity; receptor signaling protein tyrosine kinase inhibitor activity; |
◆ Recombinant Proteins | ||
Ahsg-557M | Recombinant Mouse Ahsg Protein, MYC/DDK-tagged | +Inquiry |
Ahsg-7155M | Recombinant Mouse Ahsg Protein, His-tagged | +Inquiry |
Ahsg-674M | Active Recombinant Mouse Ahsg Protein, His-tagged | +Inquiry |
aHSG-3325R | Recombinant Rat aHSG, His-tagged | +Inquiry |
AHSG-952HF | Recombinant Full Length Human AHSG Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *