Recombinant Human AIF1L Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | AIF1L-3887H |
| Product Overview : | AIF1L MS Standard C13 and N15-labeled recombinant protein (NP_113614) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | AIF1L (Allograft Inflammatory Factor 1 Like) is a Protein Coding gene. Diseases associated with AIF1L include Bronchus Cancer. Gene Ontology (GO) annotations related to this gene include calcium ion binding and actin filament binding. An important paralog of this gene is AIF1. |
| Molecular Mass : | 16.9 kDa |
| AA Sequence : | MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | AIF1L allograft inflammatory factor 1-like [ Homo sapiens (human) ] |
| Official Symbol | AIF1L |
| Synonyms | AIF1L; allograft inflammatory factor 1-like; C9orf58, chromosome 9 open reading frame 58; FLJ12783; IBA2; ionized calcium binding adapter molecule 2; ionized calcium-binding adapter molecule 2; C9orf58; MGC29466; |
| Gene ID | 83543 |
| mRNA Refseq | NM_031426 |
| Protein Refseq | NP_113614 |
| UniProt ID | Q9BQI0 |
| ◆ Recombinant Proteins | ||
| ANP32B-618H | Recombinant Human ANP32B protein, GST-tagged | +Inquiry |
| AIF1L-3444H | Recombinant Human AIF1L protein, His-tagged | +Inquiry |
| AIF1L-9861Z | Recombinant Zebrafish AIF1L | +Inquiry |
| ANP32B-338R | Recombinant Rhesus monkey ANP32B Protein, His-tagged | +Inquiry |
| AIF1L-2582HF | Recombinant Full Length Human AIF1L Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANP32B-035HKCL | Human ANP32B Knockdown Cell Lysate | +Inquiry |
| AIF1L-8955HCL | Recombinant Human AIF1L 293 Cell Lysate | +Inquiry |
| ANP32B-8842HCL | Recombinant Human ANP32B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANP32B Products
Required fields are marked with *
My Review for All ANP32B Products
Required fields are marked with *
