Recombinant Human AIFM1 protein, His-SUMO-tagged
| Cat.No. : | AIFM1-2499H |
| Product Overview : | Recombinant Human AIFM1 protein(O95831)(103-612aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 103-612aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 71.6 kDa |
| AA Sequence : | GLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | AIFM1 apoptosis-inducing factor, mitochondrion-associated, 1 [ Homo sapiens ] |
| Official Symbol | AIFM1 |
| Synonyms | AIFM1; apoptosis-inducing factor, mitochondrion-associated, 1; PDCD8, programmed cell death 8 (apoptosis inducing factor); apoptosis-inducing factor 1, mitochondrial; AIF; striatal apoptosis-inducing factor; programmed cell death 8 (apoptosis-inducing factor); PDCD8; COXPD6; MGC111425; |
| Gene ID | 9131 |
| mRNA Refseq | NM_001130846 |
| Protein Refseq | NP_001124318 |
| MIM | 300169 |
| UniProt ID | O95831 |
| ◆ Recombinant Proteins | ||
| AIFM1-576R | Recombinant Rat AIFM1 Protein | +Inquiry |
| AIFM1-279R | Recombinant Rhesus monkey AIFM1 Protein, His-tagged | +Inquiry |
| AIFM1-0460H | Recombinant Human AIFM1 Protein (Leu102-Asp613), N-His-tagged | +Inquiry |
| Aifm1-104R | Recombinant Rat Aifm1 Protein, His-tagged | +Inquiry |
| AIFM1-473H | Recombinant Human AIFM1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AIFM1-8954HCL | Recombinant Human AIFM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIFM1 Products
Required fields are marked with *
My Review for All AIFM1 Products
Required fields are marked with *
