Recombinant Human AIFM2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AIFM2-1266H
Product Overview : AIFM2 MS Standard C13 and N15-labeled recombinant protein (NP_116186) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells.
Molecular Mass : 40.5 kDa
AA Sequence : MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AIFM2 apoptosis inducing factor mitochondria associated 2 [ Homo sapiens (human) ]
Official Symbol AIFM2
Synonyms AIFM2; apoptosis-inducing factor, mitochondrion-associated, 2; AMID, apoptosis inducing factor (AIF) like mitochondrion associated inducer of death; apoptosis-inducing factor 2; FLJ14497; PRG3; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; AMID; RP11-367H5.2; DKFZp686L1298;
Gene ID 84883
mRNA Refseq NM_032797
Protein Refseq NP_116186
MIM 605159
UniProt ID Q9BRQ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIFM2 Products

Required fields are marked with *

My Review for All AIFM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon