Recombinant Human AIFM2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AIFM2-1266H
• Product Overview: AIFM2 MS Standard C13 and N15-labeled recombinant protein (NP_116186) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells.
• Molecular Mass: 40.5 kDa
• AA Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AIFM2 apoptosis inducing factor mitochondria associated 2 [ Homo sapiens (human) ]
• Official Symbol: AIFM2
• Synonyms: AIFM2; apoptosis-inducing factor, mitochondrion-associated, 2; AMID, apoptosis inducing factor (AIF) like mitochondrion associated inducer of death; apoptosis-inducing factor 2; FLJ14497; PRG3; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; AMID; RP11-367H5.2; DKFZp686L1298
• Gene ID: 84883
• mRNA Refseq: NM_032797
• Protein Refseq: NP_116186
• MIM: 605159
• UniProt ID: Q9BRQ8