Recombinant Human AIP Protein, GST-tagged

Cat.No. : AIP-479H
Product Overview : Human AIP partial ORF ( NP_003968.1, 156 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]
Molecular Mass : 36.08 kDa
AA Sequence : KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AIP aryl hydrocarbon receptor interacting protein [ Homo sapiens ]
Official Symbol AIP
Synonyms AIP; aryl hydrocarbon receptor interacting protein; AH receptor-interacting protein; ARA9; FKBP16; XAP2; immunophilin homolog ARA9; HBV X-associated protein 2; XAP-2; FKBP37; SMTPHN;
Gene ID 9049
mRNA Refseq NM_003977
Protein Refseq NP_003968
MIM 605555
UniProt ID O00170

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIP Products

Required fields are marked with *

My Review for All AIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon