Recombinant Human AIP Protein, GST-tagged
Cat.No. : | AIP-479H |
Product Overview : | Human AIP partial ORF ( NP_003968.1, 156 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 36.08 kDa |
AA Sequence : | KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AIP aryl hydrocarbon receptor interacting protein [ Homo sapiens ] |
Official Symbol | AIP |
Synonyms | AIP; aryl hydrocarbon receptor interacting protein; AH receptor-interacting protein; ARA9; FKBP16; XAP2; immunophilin homolog ARA9; HBV X-associated protein 2; XAP-2; FKBP37; SMTPHN; |
Gene ID | 9049 |
mRNA Refseq | NM_003977 |
Protein Refseq | NP_003968 |
MIM | 605555 |
UniProt ID | O00170 |
◆ Recombinant Proteins | ||
AIP-281R | Recombinant Rhesus monkey AIP Protein, His-tagged | +Inquiry |
AIP-234R | Recombinant Rat AIP Protein, His (Fc)-Avi-tagged | +Inquiry |
AIP-417M | Recombinant Mouse AIP Protein, His (Fc)-Avi-tagged | +Inquiry |
AIP-578R | Recombinant Rat AIP Protein | +Inquiry |
AIP-6039C | Recombinant Chicken AIP | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIP-8950HCL | Recombinant Human AIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIP Products
Required fields are marked with *
My Review for All AIP Products
Required fields are marked with *
0
Inquiry Basket