Recombinant Human AK1 protein, GST-tagged
| Cat.No. : | AK1-9511H |
| Product Overview : | Recombinant Human AK1 protein(1-194 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | October 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-194 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
| Gene Name | AK1 adenylate kinase 1 [ Homo sapiens ] |
| Official Symbol | AK1 |
| Synonyms | AK1; adenylate kinase 1; adenylate kinase isoenzyme 1; AK 1; myokinase; ATP-AMP transphosphorylase 1; |
| Gene ID | 203 |
| mRNA Refseq | NM_000476 |
| Protein Refseq | NP_000467 |
| MIM | 103000 |
| UniProt ID | P00568 |
| ◆ Recombinant Proteins | ||
| AK1-2500H | Recombinant Human AK1 protein, His-SUMO-tagged | +Inquiry |
| AK1-1192Z | Recombinant Zebrafish AK1 | +Inquiry |
| Ak1-3186R | Recombinant Rat Ak1, His-tagged | +Inquiry |
| AK1-962HF | Recombinant Full Length Human AK1 Protein, GST-tagged | +Inquiry |
| AK1-6666C | Recombinant Chicken AK1 | +Inquiry |
| ◆ Native Proteins | ||
| AK1-6667C | Active Native Chicken AK1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AK1-8948HCL | Recombinant Human AK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK1 Products
Required fields are marked with *
My Review for All AK1 Products
Required fields are marked with *
