Recombinant Human AK1 protein, His-SUMO-tagged
Cat.No. : | AK1-2500H |
Product Overview : | Recombinant Human AK1 protein(P00568)(1-194aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-194aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.6 kDa |
AA Sequence : | MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | AK1 adenylate kinase 1 [ Homo sapiens ] |
Official Symbol | AK1 |
Synonyms | AK1; adenylate kinase 1; adenylate kinase isoenzyme 1; AK 1; myokinase; ATP-AMP transphosphorylase 1; |
Gene ID | 203 |
mRNA Refseq | NM_000476 |
Protein Refseq | NP_000467 |
MIM | 103000 |
UniProt ID | P00568 |
◆ Recombinant Proteins | ||
AK1-300H | Recombinant Human AK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AK1-2864H | Recombinant Human Adenylate Kinase 1, His-tagged | +Inquiry |
AK1-9511H | Recombinant Human AK1 protein, GST-tagged | +Inquiry |
Ak1-3186R | Recombinant Rat Ak1, His-tagged | +Inquiry |
AK1-582R | Recombinant Rat AK1 Protein | +Inquiry |
◆ Native Proteins | ||
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK1-8948HCL | Recombinant Human AK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK1 Products
Required fields are marked with *
My Review for All AK1 Products
Required fields are marked with *