Recombinant Human AK1 Protein, GST-tagged
Cat.No. : | AK1-483H |
Product Overview : | Human AK1 full-length ORF ( AAH01116, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 47.08 kDa |
AA Sequence : | MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AK1 adenylate kinase 1 [ Homo sapiens ] |
Official Symbol | AK1 |
Synonyms | AK1; adenylate kinase 1; adenylate kinase isoenzyme 1; AK 1; myokinase; ATP-AMP transphosphorylase 1; |
Gene ID | 203 |
mRNA Refseq | NM_000476 |
Protein Refseq | NP_000467 |
MIM | 103000 |
UniProt ID | P00568 |
◆ Recombinant Proteins | ||
Ak1-561M | Recombinant Mouse Ak1 Protein, MYC/DDK-tagged | +Inquiry |
AK1-1123R | Recombinant Rat AK1 protein(Met1-Lys194), His-tagged | +Inquiry |
AK1-1462M | Recombinant Mouse AK1 Protein | +Inquiry |
AK1-582R | Recombinant Rat AK1 Protein | +Inquiry |
AK1-6666C | Recombinant Chicken AK1 | +Inquiry |
◆ Native Proteins | ||
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK1-8948HCL | Recombinant Human AK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK1 Products
Required fields are marked with *
My Review for All AK1 Products
Required fields are marked with *