Recombinant Human AK2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AK2-685H |
Product Overview : | AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AK2 adenylate kinase 2 [ Homo sapiens (human) ] |
Official Symbol | AK2 |
Synonyms | AK2; adenylate kinase 2; adenylate kinase 2, mitochondrial; ATP-AMP transphosphorylase 2; adenylate kinase isoenzyme 2, mitochondrial; ADK2; AK 2; |
Gene ID | 204 |
mRNA Refseq | NM_001625 |
Protein Refseq | NP_001616 |
MIM | 103020 |
UniProt ID | P54819 |
◆ Recombinant Proteins | ||
AK2-2501H | Recombinant Human AK2 protein, GST-tagged | +Inquiry |
AK2-421M | Recombinant Mouse AK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AK2-484H | Recombinant Human AK2 Protein, GST-tagged | +Inquiry |
AK2-6786H | Recombinant Human AK2 protein, His-tagged | +Inquiry |
AK2-283R | Recombinant Rhesus monkey AK2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK2-508HCL | Recombinant Human AK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AK2 Products
Required fields are marked with *
My Review for All AK2 Products
Required fields are marked with *
0
Inquiry Basket