"AKAP6" Related Products

Recombinant Human AKAP6 protein, GST-tagged

Cat.No.: AKAP6-32H
Product Overview: Recombinant Human AKAP6(2221 a.a. - 2318 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.52 kDa
AA Sequence: RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHP SPKTLTCEENLLNLHEKRHRNMH
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: AKAP6 A kinase (PRKA) anchor protein 6 [ Homo sapiens ]
Official Symbol: AKAP6
Synonyms: AKAP6; A kinase (PRKA) anchor protein 6; A-kinase anchor protein 6; ADAP6; AKAP100; KIAA0311; mAKAP; PRKA6; protein kinase A anchoring protein 6; AKAP-6; AKAP 100; A-kinase anchor protein 100 kDa; protein kinase A-anchoring protein 6; ADAP100; MGC165020;
Gene ID: 9472
mRNA Refseq: NM_004274
Protein Refseq: NP_004265
MIM: 604691
UniProt ID: Q13023
Chromosome Location: 14q12
Pathway: G Protein Signaling Pathways, organism-specific biosystem;
Function: enzyme binding; protein N-terminus binding; protein complex scaffold; protein kinase A binding; protein kinase A binding; protein kinase A regulatory subunit binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.