Recombinant Human AKAP6 protein, GST-tagged
Cat.No. : | AKAP6-32H |
Product Overview : | Recombinant Human AKAP6(2221 a.a. - 2318 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 2221-2318 a.a. |
Description : | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHP SPKTLTCEENLLNLHEKRHRNMH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | AKAP6 A kinase (PRKA) anchor protein 6 [ Homo sapiens ] |
Official Symbol | AKAP6 |
Synonyms | AKAP6; A kinase (PRKA) anchor protein 6; A-kinase anchor protein 6; ADAP6; AKAP100; KIAA0311; mAKAP; PRKA6; protein kinase A anchoring protein 6; AKAP-6; AKAP 100; A-kinase anchor protein 100 kDa; protein kinase A-anchoring protein 6; ADAP100; MGC165020; |
Gene ID | 9472 |
mRNA Refseq | NM_004274 |
Protein Refseq | NP_004265 |
MIM | 604691 |
UniProt ID | Q13023 |
Chromosome Location | 14q12 |
Pathway | G Protein Signaling Pathways, organism-specific biosystem; |
Function | enzyme binding; protein N-terminus binding; protein complex scaffold; protein kinase A binding; protein kinase A binding; protein kinase A regulatory subunit binding; receptor binding; |
◆ Recombinant Proteins | ||
AKAP6-9523H | Recombinant Human AKAP6, GST-tagged | +Inquiry |
AKAP6-715H | Recombinant Human AKAP6 | +Inquiry |
AKAP6-32H | Recombinant Human AKAP6 protein, GST-tagged | +Inquiry |
AKAP6-2452H | Recombinant Human AKAP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKAP6-592R | Recombinant Rat AKAP6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKAP6 Products
Required fields are marked with *
My Review for All AKAP6 Products
Required fields are marked with *
0
Inquiry Basket