Recombinant Human AKAP6 protein, GST-tagged

Cat.No. : AKAP6-32H
Product Overview : Recombinant Human AKAP6(2221 a.a. - 2318 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 2221-2318 a.a.
Description : The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.52 kDa
AA Sequence : RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHP SPKTLTCEENLLNLHEKRHRNMH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name AKAP6 A kinase (PRKA) anchor protein 6 [ Homo sapiens ]
Official Symbol AKAP6
Synonyms AKAP6; A kinase (PRKA) anchor protein 6; A-kinase anchor protein 6; ADAP6; AKAP100; KIAA0311; mAKAP; PRKA6; protein kinase A anchoring protein 6; AKAP-6; AKAP 100; A-kinase anchor protein 100 kDa; protein kinase A-anchoring protein 6; ADAP100; MGC165020;
Gene ID 9472
mRNA Refseq NM_004274
Protein Refseq NP_004265
MIM 604691
UniProt ID Q13023
Chromosome Location 14q12
Pathway G Protein Signaling Pathways, organism-specific biosystem;
Function enzyme binding; protein N-terminus binding; protein complex scaffold; protein kinase A binding; protein kinase A binding; protein kinase A regulatory subunit binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKAP6 Products

Required fields are marked with *

My Review for All AKAP6 Products

Required fields are marked with *

0
cart-icon