Recombinant Human AKIRIN1 Protein, GST-tagged

• Cat.No.: AKIRIN1-406H
• Product Overview: Human AKIRIN1 full-length ORF (1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: AKIRIN1 (Akirin 1) is a Protein Coding gene. An important paralog of this gene is AKIRIN2.
• Molecular Mass: 48.3 kDa
• AA Sequence: MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKIRIN1 akirin 1 [ Homo sapiens (human) ]
• Official Symbol: AKIRIN1
• Synonyms: AKIRIN1; akirin 1; STRF2; C1orf108; akirin-1
• Gene ID: 79647
• mRNA Refseq: NM_001136275
• Protein Refseq: NP_001129747
• MIM: 615164
• UniProt ID: Q9H9L7