Recombinant Human AKIRIN1 Protein, GST-tagged
Cat.No. : | AKIRIN1-406H |
Product Overview : | Human AKIRIN1 full-length ORF (1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AKIRIN1 (Akirin 1) is a Protein Coding gene. An important paralog of this gene is AKIRIN2. |
Molecular Mass : | 48.3 kDa |
AA Sequence : | MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKIRIN1 akirin 1 [ Homo sapiens (human) ] |
Official Symbol | AKIRIN1 |
Synonyms | AKIRIN1; akirin 1; STRF2; C1orf108; akirin-1; |
Gene ID | 79647 |
mRNA Refseq | NM_001136275 |
Protein Refseq | NP_001129747 |
MIM | 615164 |
UniProt ID | Q9H9L7 |
◆ Recombinant Proteins | ||
akirin1-1082S | Recombinant Silurana tropicalis akirin1 protein, His&Myc-tagged | +Inquiry |
AKIRIN1-1358HF | Recombinant Full Length Human AKIRIN1 Protein, GST-tagged | +Inquiry |
AKIRIN1-1661Z | Recombinant Zebrafish AKIRIN1 | +Inquiry |
AKIRIN1-406H | Recombinant Human AKIRIN1 Protein, GST-tagged | +Inquiry |
AKIRIN1-6376Z | Recombinant Zebrafish AKIRIN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKIRIN1 Products
Required fields are marked with *
My Review for All AKIRIN1 Products
Required fields are marked with *