Recombinant Human AKIRIN1 Protein, GST-tagged

Cat.No. : AKIRIN1-406H
Product Overview : Human AKIRIN1 full-length ORF (1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AKIRIN1 (Akirin 1) is a Protein Coding gene. An important paralog of this gene is AKIRIN2.
Molecular Mass : 48.3 kDa
AA Sequence : MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKIRIN1 akirin 1 [ Homo sapiens (human) ]
Official Symbol AKIRIN1
Synonyms AKIRIN1; akirin 1; STRF2; C1orf108; akirin-1;
Gene ID 79647
mRNA Refseq NM_001136275
Protein Refseq NP_001129747
MIM 615164
UniProt ID Q9H9L7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKIRIN1 Products

Required fields are marked with *

My Review for All AKIRIN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon