Recombinant Human AKNA Protein, GST-tagged

Cat.No. : AKNA-407H
Product Overview : Human AKNA partial ORF ( NP_110394.2, 1363 a.a. - 1439 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AKNA (AT-Hook Transcription Factor) is a Protein Coding gene. GO annotations related to this gene include RNA polymerase II core promoter proximal region sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding.
Molecular Mass : 34.21 kDa
AA Sequence : PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESVRSTTRQMRSSLSADLRQAHSLRGSCLF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKNA AT-hook transcription factor [ Homo sapiens ]
Official Symbol AKNA
Synonyms AKNA; AT-hook transcription factor; AT-hook-containing transcription factor; KIAA1968; AKNA transcript F2; AT-hook transcription factor AKNA; RP11-82I1.4; FLJ31001; FLJ33184;
Gene ID 80709
mRNA Refseq NM_030767
Protein Refseq NP_110394
MIM 605729
UniProt ID Q7Z591

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKNA Products

Required fields are marked with *

My Review for All AKNA Products

Required fields are marked with *

0
cart-icon