Recombinant Human AKNA Protein, GST-tagged
Cat.No. : | AKNA-407H |
Product Overview : | Human AKNA partial ORF ( NP_110394.2, 1363 a.a. - 1439 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AKNA (AT-Hook Transcription Factor) is a Protein Coding gene. GO annotations related to this gene include RNA polymerase II core promoter proximal region sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding. |
Molecular Mass : | 34.21 kDa |
AA Sequence : | PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESVRSTTRQMRSSLSADLRQAHSLRGSCLF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKNA AT-hook transcription factor [ Homo sapiens ] |
Official Symbol | AKNA |
Synonyms | AKNA; AT-hook transcription factor; AT-hook-containing transcription factor; KIAA1968; AKNA transcript F2; AT-hook transcription factor AKNA; RP11-82I1.4; FLJ31001; FLJ33184; |
Gene ID | 80709 |
mRNA Refseq | NM_030767 |
Protein Refseq | NP_110394 |
MIM | 605729 |
UniProt ID | Q7Z591 |
◆ Recombinant Proteins | ||
AKNA-407H | Recombinant Human AKNA Protein, GST-tagged | +Inquiry |
AKNA-1487M | Recombinant Mouse AKNA Protein | +Inquiry |
AKNA-434M | Recombinant Mouse AKNA Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKNA Products
Required fields are marked with *
My Review for All AKNA Products
Required fields are marked with *
0
Inquiry Basket