Recombinant Human AKNA Protein, GST-tagged

• Cat.No.: AKNA-407H
• Product Overview: Human AKNA partial ORF ( NP_110394.2, 1363 a.a. - 1439 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: AKNA (AT-Hook Transcription Factor) is a Protein Coding gene. GO annotations related to this gene include RNA polymerase II core promoter proximal region sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding.
• Molecular Mass: 34.21 kDa
• AA Sequence: PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESVRSTTRQMRSSLSADLRQAHSLRGSCLF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKNA AT-hook transcription factor [ Homo sapiens ]
• Official Symbol: AKNA
• Synonyms: AKNA; AT-hook transcription factor; AT-hook-containing transcription factor; KIAA1968; AKNA transcript F2; AT-hook transcription factor AKNA; RP11-82I1.4; FLJ31001; FLJ33184
• Gene ID: 80709
• mRNA Refseq: NM_030767
• Protein Refseq: NP_110394
• MIM: 605729
• UniProt ID: Q7Z591