Recombinant Human AKR1C2 protein, His-SUMO-tagged
Cat.No. : | AKR1C2-2502H |
Product Overview : | Recombinant Human AKR1C2 protein(P52895)(1-323aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-323aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.7 kDa |
AA Sequence : | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ] |
Official Symbol | AKR1C2 |
Synonyms | AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; HBAB; SRXY8; AKR1C-pseudo; FLJ53800; |
Gene ID | 1646 |
mRNA Refseq | NM_001135241 |
Protein Refseq | NP_001128713 |
MIM | 600450 |
UniProt ID | P52895 |
◆ Recombinant Proteins | ||
AKR1C2-412H | Recombinant Human AKR1C2 Protein, GST-tagged | +Inquiry |
AKR1C2-858H | Recombinant Human AKR1C2 Protein, His-tagged | +Inquiry |
AKR1C2-599R | Recombinant Rat AKR1C2 Protein | +Inquiry |
AKR1C2-1367HF | Recombinant Full Length Human AKR1C2 Protein, GST-tagged | +Inquiry |
AKR1C2-16HF | Recombinant Full Length Human AKR1C2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C2-8930HCL | Recombinant Human AKR1C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1C2 Products
Required fields are marked with *
My Review for All AKR1C2 Products
Required fields are marked with *