Recombinant Human AKR1C2 protein, His-SUMO-tagged

• Cat.No.: AKR1C2-2502H
• Product Overview: Recombinant Human AKR1C2 protein(P52895)(1-323aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-323aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 52.7 kDa
• AA Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ]
• Official Symbol: AKR1C2
• Synonyms: AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; HBAB; SRXY8; AKR1C-pseudo; FLJ53800
• Gene ID: 1646
• mRNA Refseq: NM_001135241
• Protein Refseq: NP_001128713
• MIM: 600450
• UniProt ID: P52895