Recombinant Human AKR1D1 Protein, GST-tagged
| Cat.No. : | AKR1D1-417H |
| Product Overview : | Human AKR1D1 full-length ORF ( NP_005980.1, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. [provided by RefSeq, Jul 2010] |
| Molecular Mass : | 63.8 kDa |
| AA Sequence : | MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AKR1D1 aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) [ Homo sapiens ] |
| Official Symbol | AKR1D1 |
| Synonyms | AKR1D1; aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase); SRD5B1; 3-oxo-5-beta-steroid 4-dehydrogenase; delta(4)-3-oxosteroid 5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase; steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1); CBAS2; 3o5bred; |
| Gene ID | 6718 |
| mRNA Refseq | NM_001190906 |
| Protein Refseq | NP_001177835 |
| MIM | 604741 |
| UniProt ID | P51857 |
| ◆ Recombinant Proteins | ||
| AKR1D1-1674H | Recombinant Human Aldo-Keto Reductase Family 1, Member D1 (Delta 4-3-Ketosteroid-5-Beta-Reductase), His-tagged | +Inquiry |
| AKR1D1-440M | Recombinant Mouse AKR1D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AKR1D1-5633H | Recombinant Human AKR1D1 protein, His-tagged | +Inquiry |
| AKR1D1-4802C | Recombinant Chicken AKR1D1 | +Inquiry |
| AKR1D1-257R | Recombinant Rat AKR1D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AKR1D1-8928HCL | Recombinant Human AKR1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1D1 Products
Required fields are marked with *
My Review for All AKR1D1 Products
Required fields are marked with *
