Recombinant Human AKR1D1 protein, His-tagged
Cat.No. : | AKR1D1-5633H |
Product Overview : | Recombinant Human AKR1D1 protein(209-326 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 209-326 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | CQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY |
Gene Name | AKR1D1 aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) [ Homo sapiens ] |
Official Symbol | AKR1D1 |
Synonyms | AKR1D1; aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase); SRD5B1; 3-oxo-5-beta-steroid 4-dehydrogenase; delta(4)-3-oxosteroid 5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase; steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1); CBAS2; 3o5bred; |
Gene ID | 6718 |
mRNA Refseq | NM_001190906 |
Protein Refseq | NP_001177835 |
MIM | 604741 |
UniProt ID | P51857 |
◆ Recombinant Proteins | ||
Akr1d1-1583M | Recombinant Mouse Akr1d1 Protein, Myc/DDK-tagged | +Inquiry |
AKR1D1-5633H | Recombinant Human AKR1D1 protein, His-tagged | +Inquiry |
AKR1D1-257R | Recombinant Rat AKR1D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1D1-1504M | Recombinant Mouse AKR1D1 Protein | +Inquiry |
AKR1D1-417H | Recombinant Human AKR1D1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1D1-8928HCL | Recombinant Human AKR1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1D1 Products
Required fields are marked with *
My Review for All AKR1D1 Products
Required fields are marked with *
0
Inquiry Basket