Recombinant Human AKT3 protein, His-tagged
Cat.No. : | AKT3-3522H |
Product Overview : | Recombinant Human AKT3 protein(95-155 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 95-155 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | REEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLG |
Gene Name | AKT3 v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) [ Homo sapiens ] |
Official Symbol | AKT3 |
Synonyms | AKT3; v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma); RAC-gamma serine/threonine-protein kinase; PKBG; PRKBG; RAC gamma; PKB gamma; RAC-gamma serine/threonine protein kinase; STK-2; PKB-GAMMA; RAC-gamma; RAC-PK-gamma; DKFZp434N0250; |
Gene ID | 10000 |
mRNA Refseq | NM_001206729 |
Protein Refseq | NP_001193658 |
MIM | 611223 |
UniProt ID | Q9Y243 |
◆ Recombinant Proteins | ||
AKT3-3522H | Recombinant Human AKT3 protein, His-tagged | +Inquiry |
AKT3-2522H | Recombinant Human AKT3, Active | +Inquiry |
Akt3-1586M | Recombinant Mouse Akt3 Protein, Myc/DDK-tagged | +Inquiry |
AKT3-3223M | Active Recombinant Mouse AKT3 protein(Ala106-Glu479) | +Inquiry |
AKT3-426H | Active Recombinant Human AKT3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKT3-728HCL | Recombinant Human AKT3 cell lysate | +Inquiry |
AKT3-001MCL | Recombinant Mouse AKT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKT3 Products
Required fields are marked with *
My Review for All AKT3 Products
Required fields are marked with *
0
Inquiry Basket