Recombinant Human ALAD, His-tagged

Cat.No. : ALAD-26880TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-226 of Human ALAD with N terminal His tag; MWt 26kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-226 a.a.
Description : The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 109 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDV PDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLI FGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLL VACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVA LAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVM SYSAKFASCFYGPFRDAAKSSPAFGDRRCYQL
Gene Name ALAD aminolevulinate dehydratase [ Homo sapiens ]
Official Symbol ALAD
Synonyms ALAD; aminolevulinate dehydratase; aminolevulinate, delta , dehydratase; delta-aminolevulinic acid dehydratase; ALADH; PBGS; porphobilinogen synthase;
Gene ID 210
mRNA Refseq NM_000031
Protein Refseq NP_000022
MIM 125270
Uniprot ID P13716
Chromosome Location 9q32
Pathway Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of porphyrins, organism-specific biosystem;
Function catalytic activity; identical protein binding; lead ion binding; lyase activity; porphobilinogen synthase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALAD Products

Required fields are marked with *

My Review for All ALAD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon