Recombinant Human ALAD, His-tagged
Cat.No. : | ALAD-26880TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-226 of Human ALAD with N terminal His tag; MWt 26kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-226 a.a. |
Description : | The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 109 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDV PDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLI FGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLL VACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVA LAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVM SYSAKFASCFYGPFRDAAKSSPAFGDRRCYQL |
Gene Name | ALAD aminolevulinate dehydratase [ Homo sapiens ] |
Official Symbol | ALAD |
Synonyms | ALAD; aminolevulinate dehydratase; aminolevulinate, delta , dehydratase; delta-aminolevulinic acid dehydratase; ALADH; PBGS; porphobilinogen synthase; |
Gene ID | 210 |
mRNA Refseq | NM_000031 |
Protein Refseq | NP_000022 |
MIM | 125270 |
Uniprot ID | P13716 |
Chromosome Location | 9q32 |
Pathway | Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of porphyrins, organism-specific biosystem; |
Function | catalytic activity; identical protein binding; lead ion binding; lyase activity; porphobilinogen synthase activity; |
◆ Recombinant Proteins | ||
ALAD-265R | Recombinant Rat ALAD Protein, His (Fc)-Avi-tagged | +Inquiry |
ALAD-1387HF | Recombinant Full Length Human ALAD Protein, GST-tagged | +Inquiry |
ALAD-6108H | Recombinant Human ALAD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALAD-292C | Recombinant Cynomolgus ALAD Protein, His-tagged | +Inquiry |
ALAD-609R | Recombinant Rat ALAD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALAD-54HCL | Recombinant Human ALAD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALAD Products
Required fields are marked with *
My Review for All ALAD Products
Required fields are marked with *
0
Inquiry Basket