| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
153-509 a.a. |
| Description : |
This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Conjugation : |
HIS |
| Form : |
Lyophilised:Reconstitute with 73 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
ADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQ AWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGF PPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGR VIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAH FALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSR VVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKL LCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQA LQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQ AYTEVKTVT |
| Sequence Similarities : |
Belongs to the aldehyde dehydrogenase family. |