Recombinant Human ALDH3B1 protein, His-tagged
Cat.No. : | ALDH3B1-495H |
Product Overview : | Recombinant Human ALDH3B1 protein(1-230 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-230 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHPSKQRLPPPSWVFPLPASASSLSRSQP |
Gene Name | ALDH3B1 aldehyde dehydrogenase 3 family, member B1 [ Homo sapiens ] |
Official Symbol | ALDH3B1 |
Synonyms | ALDH3B1; aldehyde dehydrogenase 3 family, member B1; ALDH7; aldehyde dehydrogenase family 3 member B1; aldehyde dehydrogenase 3B1; aldehyde dehydrogenase 7; ALDH4; FLJ26433; FLJ34710; |
Gene ID | 221 |
mRNA Refseq | NM_000694 |
Protein Refseq | NP_000685 |
MIM | 600466 |
UniProt ID | P43353 |
◆ Recombinant Proteins | ||
ABHD2-867HFL | Recombinant Full Length Human ABHD2 Protein, C-Flag-tagged | +Inquiry |
ALDH3B1-495H | Recombinant Human ALDH3B1 protein, His-tagged | +Inquiry |
ABHD2-4893H | Recombinant Human ABHD2 protein, MYC/DDK-tagged | +Inquiry |
RFL-5150HF | Recombinant Full Length Human Monoacylglycerol Lipase Abhd2(Abhd2) Protein, His-Tagged | +Inquiry |
AGXT-84838H | Recombinant Human AGXT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD2-9134HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
ABHD2-9135HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD2 Products
Required fields are marked with *
My Review for All ABHD2 Products
Required fields are marked with *