Recombinant Human AAMP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AAMP-474H |
Product Overview : | AAMP MS Standard C13 and N15-labeled recombinant protein (NP_001078) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion. |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AAMP angio associated migratory cell protein [ Homo sapiens (human) ] |
Official Symbol | AAMP |
Synonyms | AAMP; angio-associated, migratory cell protein; angio-associated migratory cell protein; |
Gene ID | 14 |
mRNA Refseq | NM_001087 |
Protein Refseq | NP_001078 |
MIM | 603488 |
UniProt ID | Q13685 |
◆ Recombinant Proteins | ||
AAMP-173R | Recombinant Rhesus monkey AAMP Protein, His-tagged | +Inquiry |
AAMP-3548H | Recombinant Human AAMP protein, His-tagged | +Inquiry |
AAMP-020H | Recombinant Human AAMP Protein, GST-tagged | +Inquiry |
AAMP-242H | Recombinant Human AAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
AAMP-751HF | Recombinant Full Length Human AAMP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAMP-9157HCL | Recombinant Human AAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAMP Products
Required fields are marked with *
My Review for All AAMP Products
Required fields are marked with *
0
Inquiry Basket