Recombinant Human ALDH9A1 protein, His-tagged

Cat.No. : ALDH9A1-3945H
Product Overview : Recombinant Human ALDH9A1 protein(285-412 aa), fused to His tag, was expressed in E. coli.
Availability December 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 285-412 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ALDH9A1 aldehyde dehydrogenase 9 family, member A1 [ Homo sapiens ]
Official Symbol ALDH9A1
Synonyms ALDH9A1; aldehyde dehydrogenase 9 family, member A1; ALDH4, ALDH7, ALDH9; 4-trimethylaminobutyraldehyde dehydrogenase; E3; aldehyde dehydrogenase (NAD+); aldehyde dehydrogenase E3 isozyme; R-aminobutyraldehyde dehydrogenase; gamma-aminobutyraldehyde dehydrogenase; aldehyde dehydrogenase family 9 member A1; ALDH4; ALDH7; ALDH9; TMABADH;
Gene ID 223
mRNA Refseq NM_000696
Protein Refseq NP_000687
MIM 602733
UniProt ID P49189

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALDH9A1 Products

Required fields are marked with *

My Review for All ALDH9A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon