Recombinant Human ALDH9A1 protein, His-tagged

• Cat.No.: ALDH9A1-3945H
• Product Overview: Recombinant Human ALDH9A1 protein(285-412 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 285-412 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ALDH9A1 aldehyde dehydrogenase 9 family, member A1 [ Homo sapiens ]
• Official Symbol: ALDH9A1
• Synonyms: ALDH9A1; aldehyde dehydrogenase 9 family, member A1; ALDH4, ALDH7, ALDH9; 4-trimethylaminobutyraldehyde dehydrogenase; E3; aldehyde dehydrogenase (NAD+); aldehyde dehydrogenase E3 isozyme; R-aminobutyraldehyde dehydrogenase; gamma-aminobutyraldehyde dehydrogenase; aldehyde dehydrogenase family 9 member A1; ALDH4; ALDH7; ALDH9; TMABADH
• Gene ID: 223
• mRNA Refseq: NM_000696
• Protein Refseq: NP_000687
• MIM: 602733
• UniProt ID: P49189