Recombinant Human ALG13 protein, GST-tagged
Cat.No. : | ALG13-4633H |
Product Overview : | Recombinant Human ALG13 protein(45-127 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 45-127 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTC |
Gene Name | ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ALG13 |
Synonyms | ALG13; asparagine-linked glycosylation 13 homolog (S. cerevisiae); chromosome X open reading frame 45 , CXorf45, GLT28D1, glycosyltransferase 28 domain containing 1; UDP-N-acetylglucosamine transferase subunit ALG13 homolog; FLJ23018; MDS031; YGL047W; glycosyltransferase 28 domain-containing protein 1; hematopoietic stem/progenitor cells protein MDS031; CXorf45; GLT28D1; FLJ31785; MGC12423; |
Gene ID | 79868 |
mRNA Refseq | NM_001039210 |
Protein Refseq | NP_001034299 |
MIM | 300776 |
UniProt ID | Q9NP73 |
◆ Recombinant Proteins | ||
ALG13-0611H | Recombinant Human ALG13 Protein (S221-D372), His tagged | +Inquiry |
ALG13-284R | Recombinant Rat ALG13 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALG13-9574H | Recombinant Human ALG13 protein, GST-tagged | +Inquiry |
ALG13-628R | Recombinant Rat ALG13 Protein | +Inquiry |
ALG13-0610H | Recombinant Human ALG13 Protein (S221-D372), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALG13-8908HCL | Recombinant Human ALG13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG13 Products
Required fields are marked with *
My Review for All ALG13 Products
Required fields are marked with *