Recombinant Human ALG13 protein, His-tagged
| Cat.No. : | ALG13-9573H |
| Product Overview : | Recombinant Human ALG13 protein(1-165 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 10, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-165 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK |
| Gene Name | ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ALG13 |
| Synonyms | ALG13; asparagine-linked glycosylation 13 homolog (S. cerevisiae); chromosome X open reading frame 45 , CXorf45, GLT28D1, glycosyltransferase 28 domain containing 1; UDP-N-acetylglucosamine transferase subunit ALG13 homolog; FLJ23018; MDS031; YGL047W; glycosyltransferase 28 domain-containing protein 1; hematopoietic stem/progenitor cells protein MDS031; CXorf45; GLT28D1; FLJ31785; MGC12423; |
| Gene ID | 79868 |
| mRNA Refseq | NM_001039210 |
| Protein Refseq | NP_001034299 |
| MIM | 300776 |
| UniProt ID | Q9NP73 |
| ◆ Recombinant Proteins | ||
| ALG13-464M | Recombinant Mouse ALG13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALG13-4633H | Recombinant Human ALG13 protein, GST-tagged | +Inquiry |
| ALG13-9573H | Recombinant Human ALG13 protein, His-tagged | +Inquiry |
| ALG13-1544M | Recombinant Mouse ALG13 Protein | +Inquiry |
| ALG13-284R | Recombinant Rat ALG13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALG13-8908HCL | Recombinant Human ALG13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG13 Products
Required fields are marked with *
My Review for All ALG13 Products
Required fields are marked with *
