Recombinant Human ALG2 protein, His-tagged
Cat.No. : | ALG2-8655H |
Product Overview : | Recombinant Human ALG2 protein(32-323 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 32-323 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | RLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV |
Gene Name | ALG2 asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ALG2 |
Synonyms | ALG2; asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 2 homolog (yeast, alpha 1,3 mannosyltransferase); alpha-1,3/1,6-mannosyltransferase ALG2; CDGIi; FLJ14511; hALPG2; NET38; homolog of yeast ALG2; alpha-1,3-mannosyltransferase ALG2; asparagine-linked glycosylation protein 2 homolog; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase); |
Gene ID | 85365 |
mRNA Refseq | NM_033087 |
Protein Refseq | NP_149078 |
MIM | 607905 |
UniProt ID | Q9H553 |
◆ Recombinant Proteins | ||
ALG2-1546M | Recombinant Mouse ALG2 Protein | +Inquiry |
ALG2-9575H | Recombinant Human ALG2, His-tagged | +Inquiry |
ALG2-463H | Recombinant Human ALG2 Protein, GST-tagged | +Inquiry |
ALG2-131R | Recombinant Rhesus Macaque ALG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALG2-303R | Recombinant Rhesus monkey ALG2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALG2-8906HCL | Recombinant Human ALG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG2 Products
Required fields are marked with *
My Review for All ALG2 Products
Required fields are marked with *
0
Inquiry Basket