Recombinant Human ALG2 Protein, Myc/DDK-tagged
| Cat.No. : | ALG2-01H |
| Product Overview : | Recombinant protein of human asparagine-linked glycosylation 2, alpha-1, 3-mannosyltransferase homolog (S. cerevisiae) (ALG2), transcript variant 1 with a C-Myc/DDK tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1, 3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 46.9 kDa |
| AA Sequence : | MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 μg/mL as determined by microplate BCA method |
| Storage Buffer : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Gene Name | ALG2 ALG2 alpha-1, 3/1, 6-mannosyltransferase [ Homo sapiens (human) ] |
| Official Symbol | ALG2 |
| Synonyms | ALG2; ALG2 alpha-1, 3/1, 6-mannosyltransferase; CDG1I; CDGIi; CMS14; NET38; CMSTA3; hALPG2; alpha-1, 3/1, 6-mannosyltransferase ALG2; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1, 6-mannosyltransferase; alpha-1, 3-mannosyltransferase ALG2; asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1, 3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (yeast, alpha-1, 3-mannosyltransferase); asparagine-linked glycosylation 2, alpha-1, 3-mannosyltransferase homolog; asparagine-linked glycosylation protein 2 homolog; homolog of yeast ALG2; EC 2.4.1.132; EC 2.4.1.257 |
| Gene ID | 85365 |
| mRNA Refseq | NM_033087 |
| Protein Refseq | NP_149078 |
| MIM | 607905 |
| UniProt ID | Q9H553 |
| ◆ Cell & Tissue Lysates | ||
| ALG2-8906HCL | Recombinant Human ALG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG2 Products
Required fields are marked with *
My Review for All ALG2 Products
Required fields are marked with *



