Recombinant Human ALG2 Protein, Myc/DDK-tagged

Cat.No. : ALG2-01H
Product Overview : Recombinant protein of human asparagine-linked glycosylation 2, alpha-1, 3-mannosyltransferase homolog (S. cerevisiae) (ALG2), transcript variant 1 with a C-Myc/DDK tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1, 3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants.
Molecular Mass : 46.9 kDa
AA Sequence : MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 μg/mL as determined by microplate BCA method
Storage Buffer : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Gene Name ALG2 ALG2 alpha-1, 3/1, 6-mannosyltransferase [ Homo sapiens (human) ]
Official Symbol ALG2
Synonyms ALG2; ALG2 alpha-1, 3/1, 6-mannosyltransferase; CDG1I; CDGIi; CMS14; NET38; CMSTA3; hALPG2; alpha-1, 3/1, 6-mannosyltransferase ALG2; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1, 6-mannosyltransferase; alpha-1, 3-mannosyltransferase ALG2; asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1, 3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (yeast, alpha-1, 3-mannosyltransferase); asparagine-linked glycosylation 2, alpha-1, 3-mannosyltransferase homolog; asparagine-linked glycosylation protein 2 homolog; homolog of yeast ALG2; EC 2.4.1.132; EC 2.4.1.257
Gene ID 85365
mRNA Refseq NM_033087
Protein Refseq NP_149078
MIM 607905
UniProt ID Q9H553

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALG2 Products

Required fields are marked with *

My Review for All ALG2 Products

Required fields are marked with *

0
cart-icon