Recombinant Human ALKBH1 Protein, GST-tagged
Cat.No. : | ALKBH1-474H |
Product Overview : | Human ALKBH full-length ORF ( AAH25787.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 68.42 kDa |
AA Sequence : | MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALKBH1 alkB, alkylation repair homolog 1 (E. coli) [ Homo sapiens ] |
Official Symbol | ALKBH1 |
Synonyms | ALKBH1; alkB, alkylation repair homolog 1 (E. coli); alkB, alkylation repair homolog (E. coli) , ALKBH; alkylated DNA repair protein alkB homolog 1; ABH; alkB; hABH; DNA lyase ABH1; alkylation repair, alkB homolog; alpha-ketoglutarate-dependent dioxygenase ABH1; ABH1; ALKBH; |
Gene ID | 8846 |
mRNA Refseq | NM_006020 |
Protein Refseq | NP_006011 |
MIM | 605345 |
UniProt ID | Q13686 |
◆ Recombinant Proteins | ||
ALKBH1-2853Z | Recombinant Zebrafish ALKBH1 | +Inquiry |
ALKBH1-223HFL | Recombinant Full Length Human ALKBH1 Protein, C-Flag-tagged | +Inquiry |
ALKBH1-474H | Recombinant Human ALKBH1 Protein, GST-tagged | +Inquiry |
Alkbh1-1599M | Recombinant Mouse Alkbh1 Protein, Myc/DDK-tagged | +Inquiry |
ALKBH1-1198H | Recombinant Human ALKBH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALKBH1-8903HCL | Recombinant Human ALKBH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALKBH1 Products
Required fields are marked with *
My Review for All ALKBH1 Products
Required fields are marked with *