Recombinant Human ALKBH1 Protein, GST-tagged

Cat.No. : ALKBH1-474H
Product Overview : Human ALKBH full-length ORF ( AAH25787.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal.
Availability December 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008]
Molecular Mass : 68.42 kDa
AA Sequence : MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALKBH1 alkB, alkylation repair homolog 1 (E. coli) [ Homo sapiens ]
Official Symbol ALKBH1
Synonyms ALKBH1; alkB, alkylation repair homolog 1 (E. coli); alkB, alkylation repair homolog (E. coli) , ALKBH; alkylated DNA repair protein alkB homolog 1; ABH; alkB; hABH; DNA lyase ABH1; alkylation repair, alkB homolog; alpha-ketoglutarate-dependent dioxygenase ABH1; ABH1; ALKBH;
Gene ID 8846
mRNA Refseq NM_006020
Protein Refseq NP_006011
MIM 605345
UniProt ID Q13686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALKBH1 Products

Required fields are marked with *

My Review for All ALKBH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon