Recombinant Human ALMS1 protein, GST-tagged
Cat.No. : | ALMS1-301491H |
Product Overview : | Recombinant Human ALMS1 (2881-3000 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu2881-His3000 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LEQRELFEQSKAPRADDHVRKHHSPSPQHQDYVAPDLPSCIFLEQRELFEQCKAPYVDHQMRENHSPLPQGQDSIASDLPSPISLEQCQSKAPGVDDQMNKHHFPLPQGQDCVVEKNNQH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ALMS1 Alstrom syndrome 1 [ Homo sapiens ] |
Official Symbol | ALMS1 |
Synonyms | ALMS1; Alstrom syndrome 1; Alstrom syndrome protein 1; KIAA0328; ALSS; DKFZp686A118; DKFZp686D1828; |
Gene ID | 7840 |
mRNA Refseq | NM_015120 |
Protein Refseq | NP_055935 |
MIM | 606844 |
UniProt ID | Q8TCU4 |
◆ Recombinant Proteins | ||
ALMS1-301491H | Recombinant Human ALMS1 protein, GST-tagged | +Inquiry |
ALMS1-480M | Recombinant Mouse ALMS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAM17-2734H | Recombinant Human ADAM17 protein, GST-tagged | +Inquiry |
ALMS1-1562M | Recombinant Mouse ALMS1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALMS1 Products
Required fields are marked with *
My Review for All ALMS1 Products
Required fields are marked with *
0
Inquiry Basket