Recombinant Human ALOX15 protein, GST-tagged
Cat.No. : | ALOX15-3674H |
Product Overview : | Recombinant Human ALOX15 protein(130 - 230 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 130 - 230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | EELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ] |
Official Symbol | ALOX15 |
Synonyms | ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1; 15-LOX; 15-lipooxygenase-1; arachidonate omega-6 lipoxygenase; 15LOX-1; 15-LOX-1; |
Gene ID | 246 |
mRNA Refseq | NM_001140 |
Protein Refseq | NP_001131 |
MIM | 152392 |
UniProt ID | P16050 |
◆ Recombinant Proteins | ||
ALOX15-292R | Recombinant Rat ALOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX15-3674H | Recombinant Human ALOX15 protein, GST-tagged | +Inquiry |
ALOX15-3375H | Recombinant Human ALOX15 protein, His-tagged | +Inquiry |
ALOX15-1479HF | Recombinant Full Length Human ALOX15 Protein, GST-tagged | +Inquiry |
ALOX15-324H | Recombinant Human ALOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX15-8897HCL | Recombinant Human ALOX15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALOX15 Products
Required fields are marked with *
My Review for All ALOX15 Products
Required fields are marked with *
0
Inquiry Basket