Recombinant Human ALOX5 protein, His-tagged
| Cat.No. : | ALOX5-5744H |
| Product Overview : | Recombinant Human ALOX5 protein(1-349 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-349 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWL |
| Gene Name | ALOX5 arachidonate 5-lipoxygenase [ Homo sapiens ] |
| Official Symbol | ALOX5 |
| Synonyms | ALOX5; arachidonate 5-lipoxygenase; 5 LOX; leukotriene A4 synthase; arachidonic acid 5-lipoxygenase; arachidonic 5-lipoxygenase alpha-10 isoform; arachidonic 5-lipoxygenase delta-13 isoform; arachidonic 5-lipoxygenase delta-p10 isoform; arachidonic 5-lipoxygenase delta-10-13 isoform; 5-LO; 5LPG; LOG5; 5-LOX; MGC163204; |
| Gene ID | 240 |
| mRNA Refseq | NM_000698 |
| Protein Refseq | NP_000689 |
| MIM | 152390 |
| UniProt ID | P09917 |
| ◆ Recombinant Proteins | ||
| ALOX5-0558H | Recombinant Human ALOX5 Protein (Mey1-IIe674), C-His-tagged | +Inquiry |
| ALOX5-26026TH | Recombinant Human ALOX5 | +Inquiry |
| ALOX5-483M | Recombinant Mouse ALOX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALOX5-21HF | Recombinant Full Length Human ALOX5 Protein | +Inquiry |
| ALOX5-120H | Recombinant Human ALOX5 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALOX5-8896HCL | Recombinant Human ALOX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALOX5 Products
Required fields are marked with *
My Review for All ALOX5 Products
Required fields are marked with *



