Recombinant Human ALOX5AP Full Length Transmembrane protein (1-161 aa), His-SUMO-tagged
Cat.No. : | ALOX5AP-2725H |
Product Overview : | Recombinant Human ALOX5AP Protein (1-161 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-161aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.2 kDa |
AA Sequence : | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ALOX5AP arachidonate 5-lipoxygenase-activating protein [ Homo sapiens ] |
Official Symbol | ALOX5AP |
Synonyms | ALOX5AP; arachidonate 5-lipoxygenase-activating protein; five lipoxygenase activating protein; FLAP; MK 886 binding protein; MK-886-binding protein; |
Gene ID | 241 |
mRNA Refseq | NM_001204406 |
Protein Refseq | NP_001191335 |
MIM | 603700 |
UniProt ID | P20292 |
◆ Recombinant Proteins | ||
RFL-3714SF | Recombinant Full Length Pig Arachidonate 5-Lipoxygenase-Activating Protein(Alox5Ap) Protein, His-Tagged | +Inquiry |
Alox5ap-585M | Recombinant Mouse Alox5ap Protein, MYC/DDK-tagged | +Inquiry |
ALOX5AP-2725H | Recombinant Human ALOX5AP Full Length Transmembrane protein (1-161 aa), His-SUMO-tagged | +Inquiry |
ALOX5AP-5393C | Recombinant Chicken ALOX5AP | +Inquiry |
ALOX5AP-3336H | Recombinant Human ALOX5AP protein(Met1-Pro161), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX5AP-667HCL | Recombinant Human ALOX5AP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALOX5AP Products
Required fields are marked with *
My Review for All ALOX5AP Products
Required fields are marked with *
0
Inquiry Basket