Recombinant Human ALOX5AP Full Length Transmembrane protein (1-161 aa), His-SUMO-tagged

Cat.No. : ALOX5AP-2725H
Product Overview : Recombinant Human ALOX5AP Protein (1-161 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-161aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 34.2 kDa
AA Sequence : MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ALOX5AP arachidonate 5-lipoxygenase-activating protein [ Homo sapiens ]
Official Symbol ALOX5AP
Synonyms ALOX5AP; arachidonate 5-lipoxygenase-activating protein; five lipoxygenase activating protein; FLAP; MK 886 binding protein; MK-886-binding protein;
Gene ID 241
mRNA Refseq NM_001204406
Protein Refseq NP_001191335
MIM 603700
UniProt ID P20292

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALOX5AP Products

Required fields are marked with *

My Review for All ALOX5AP Products

Required fields are marked with *

0
cart-icon