Recombinant Human ALPI protein(291-370 aa), C-His-tagged
| Cat.No. : | ALPI-2617H |
| Product Overview : | Recombinant Human ALPI protein(P09923)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-370 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTL |
| Gene Name | ALPI alkaline phosphatase, intestinal [ Homo sapiens ] |
| Official Symbol | ALPI |
| Synonyms | ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase; Kasahara isozyme; glycerophosphatase; alkaline phosphomonoesterase; intestinal alkaline phosphatase; IAP; |
| Gene ID | 248 |
| mRNA Refseq | NM_001631 |
| Protein Refseq | NP_001622 |
| MIM | 171740 |
| UniProt ID | P09923 |
| ◆ Recombinant Proteins | ||
| ALPI-514H | Active Recombinant Human ALPI Protein, His-tagged | +Inquiry |
| Alpi-1575M | Recombinant Mouse Alpi protein, His-tagged | +Inquiry |
| ALPI-024H | Recombinant Human ALPI Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ALPI-1326H | Recombinant Human ALPI Protein (20-503 aa), His-tagged | +Inquiry |
| Alpi-654R | Recombinant Rat Alpi protein(21-511aa), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ALPI-8348B | Native Bovine ALPI | +Inquiry |
| ALPI-8341C | Native Calf ALPI | +Inquiry |
| ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
| BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
| IAP-8323C | Active Native Bovine IAP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALPI-471HKCL | Human ALPI Knockdown Cell Lysate | +Inquiry |
| ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPI Products
Required fields are marked with *
My Review for All ALPI Products
Required fields are marked with *
