Recombinant Human ALPK2 Protein, GST-tagged
Cat.No. : | ALPK2-492H |
Product Overview : | Human ALPK2 partial ORF ( NP_443179, 201 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ALPK2 (Alpha Kinase 2) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity. An important paralog of this gene is ALPK3. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALPK2 alpha-kinase 2 [ Homo sapiens ] |
Official Symbol | ALPK2 |
Synonyms | ALPK2; alpha-kinase 2; alpha-protein kinase 2; HAK; heart alpha kinase; heart alpha-kinase; heart alpha-protein kinase; FLJ34875; FLJ43253; |
Gene ID | 115701 |
mRNA Refseq | NM_052947 |
Protein Refseq | NP_443179 |
UniProt ID | Q86TB3 |
◆ Recombinant Proteins | ||
ALPK2-492H | Recombinant Human ALPK2 Protein, GST-tagged | +Inquiry |
ALPK2-486M | Recombinant Mouse ALPK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALPK2-1573M | Recombinant Mouse ALPK2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPK2 Products
Required fields are marked with *
My Review for All ALPK2 Products
Required fields are marked with *