Recombinant Human ALPK3 Protein, GST-tagged
Cat.No. : | ALPK3-493H |
Product Overview : | Human ALPK3 partial ORF ( NP_065829, 1811 a.a. - 1906 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ALPK3 (Alpha Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity. An important paralog of this gene is ALPK2. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALPK3 alpha-kinase 3 [ Homo sapiens ] |
Official Symbol | ALPK3 |
Synonyms | ALPK3; alpha-kinase 3; alpha-protein kinase 3; KIAA1330; MAK; Midori; muscle alpha kinase; myocyte induction differentiation originator; muscle alpha-kinase; muscle alpha-protein kinase; MIDORI; FLJ12881; FLJ21176; |
Gene ID | 57538 |
mRNA Refseq | NM_020778 |
Protein Refseq | NP_065829 |
UniProt ID | Q96L96 |
◆ Recombinant Proteins | ||
ALPK3-493H | Recombinant Human ALPK3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPK3 Products
Required fields are marked with *
My Review for All ALPK3 Products
Required fields are marked with *