Recombinant Human ALPK3 Protein, GST-tagged

Cat.No. : ALPK3-493H
Product Overview : Human ALPK3 partial ORF ( NP_065829, 1811 a.a. - 1906 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ALPK3 (Alpha Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity. An important paralog of this gene is ALPK2.
Molecular Mass : 36.3 kDa
AA Sequence : SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALPK3 alpha-kinase 3 [ Homo sapiens ]
Official Symbol ALPK3
Synonyms ALPK3; alpha-kinase 3; alpha-protein kinase 3; KIAA1330; MAK; Midori; muscle alpha kinase; myocyte induction differentiation originator; muscle alpha-kinase; muscle alpha-protein kinase; MIDORI; FLJ12881; FLJ21176;
Gene ID 57538
mRNA Refseq NM_020778
Protein Refseq NP_065829
UniProt ID Q96L96

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALPK3 Products

Required fields are marked with *

My Review for All ALPK3 Products

Required fields are marked with *

0
cart-icon