Recombinant Human ALS2CR19 protein, GST-tagged
Cat.No. : | ALS2CR19-507H |
Product Overview : | Human ALS2CR19 partial ORF ( NP_689739, 101 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PARD3B (Par-3 Family Cell Polarity Regulator Beta) is a Protein Coding gene. Diseases associated with PARD3B include Amyotrophic Lateral Sclerosis 2, Juvenile. An important paralog of this gene is PARD3. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PARD3B par-3 family cell polarity regulator beta [ Homo sapiens (human) ] |
Official Symbol | PARD3B |
Synonyms | PARD3B; par-3 family cell polarity regulator beta; PAR3B; PAR3L; ALS2CR19; PAR3beta; partitioning defective 3 homolog B; PAR3-L protein; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein; par-3 partitioning defective 3 homolog B; partitioning defective 3-like protein; partitioning-defective 3-beta |
Gene ID | 117583 |
mRNA Refseq | NM_001302769 |
Protein Refseq | NP_001289698 |
UniProt ID | Q8TEW8 |
◆ Recombinant Proteins | ||
ALS2CR19-507H | Recombinant Human ALS2CR19 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARD3B Products
Required fields are marked with *
My Review for All PARD3B Products
Required fields are marked with *