Recombinant Human ALS2CR19 protein, GST-tagged

• Cat.No.: ALS2CR19-507H
• Product Overview: Human ALS2CR19 partial ORF ( NP_689739, 101 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PARD3B (Par-3 Family Cell Polarity Regulator Beta) is a Protein Coding gene. Diseases associated with PARD3B include Amyotrophic Lateral Sclerosis 2, Juvenile. An important paralog of this gene is PARD3.
• Molecular Mass: 37.73 kDa
• AA Sequence: SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PARD3B par-3 family cell polarity regulator beta [ Homo sapiens (human) ]
• Official Symbol: PARD3B
• Synonyms: PARD3B; par-3 family cell polarity regulator beta; PAR3B; PAR3L; ALS2CR19; PAR3beta; partitioning defective 3 homolog B; PAR3-L protein; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein; par-3 partitioning defective 3 homolog B; partitioning defective 3-like protein; partitioning-defective 3-beta
• Gene ID: 117583
• mRNA Refseq: NM_001302769
• Protein Refseq: NP_001289698
• UniProt ID: Q8TEW8