Recombinant Human ALX3 protein, GST-tagged

Cat.No. : ALX3-510H
Product Overview : Human ALX3 partial ORF ( NP_006483, 150 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a nuclear protein with a homeobox DNA-binding domain that functions as a transcriptional regulator involved in cell-type differentiation and development. Preferential methylation of this gene's promoter is associated with advanced-stage neuroblastoma tumors. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWAG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALX3 ALX homeobox 3 [ Homo sapiens ]
Official Symbol ALX3
Synonyms ALX3; ALX homeobox 3; aristaless like homeobox 3; homeobox protein aristaless-like 3; aristaless-like homeobox 3; proline-rich transcription factor ALX3; FND1; MGC138212; MGC141988;
Gene ID 257
mRNA Refseq NM_006492
Protein Refseq NP_006483
MIM 606014
UniProt ID O95076

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALX3 Products

Required fields are marked with *

My Review for All ALX3 Products

Required fields are marked with *

0
cart-icon
0
compare icon