Recombinant Human ALX3 protein, GST-tagged
Cat.No. : | ALX3-510H |
Product Overview : | Human ALX3 partial ORF ( NP_006483, 150 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a nuclear protein with a homeobox DNA-binding domain that functions as a transcriptional regulator involved in cell-type differentiation and development. Preferential methylation of this gene's promoter is associated with advanced-stage neuroblastoma tumors. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWAG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALX3 ALX homeobox 3 [ Homo sapiens ] |
Official Symbol | ALX3 |
Synonyms | ALX3; ALX homeobox 3; aristaless like homeobox 3; homeobox protein aristaless-like 3; aristaless-like homeobox 3; proline-rich transcription factor ALX3; FND1; MGC138212; MGC141988; |
Gene ID | 257 |
mRNA Refseq | NM_006492 |
Protein Refseq | NP_006483 |
MIM | 606014 |
UniProt ID | O95076 |
◆ Recombinant Proteins | ||
ALX3-510H | Recombinant Human ALX3 protein, GST-tagged | +Inquiry |
Alx3-589M | Recombinant Mouse Alx3 Protein, MYC/DDK-tagged | +Inquiry |
ALX3-511H | Recombinant Human ALX3 protein, GST-tagged | +Inquiry |
ALX3-1368H | Recombinant Human ALX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALX3-1991H | Recombinant Human ALX3 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALX3 Products
Required fields are marked with *
My Review for All ALX3 Products
Required fields are marked with *
0
Inquiry Basket