Recombinant Human ALX3 protein, GST-tagged
Cat.No. : | ALX3-511H |
Product Overview : | Recombinant Human ALX3 protein(NP_006483)(1-152 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-152 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPYLPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKNKSK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | ALX3 ALX homeobox 3 [ Homo sapiens ] |
Official Symbol | ALX3 |
Synonyms | ALX3; ALX homeobox 3; aristaless like homeobox 3; homeobox protein aristaless-like 3; aristaless-like homeobox 3; proline-rich transcription factor ALX3; FND1; MGC138212; MGC141988; |
Gene ID | 257 |
mRNA Refseq | NM_006492 |
Protein Refseq | NP_006483 |
MIM | 606014 |
UniProt ID | O95076 |
◆ Recombinant Proteins | ||
Alx3-589M | Recombinant Mouse Alx3 Protein, MYC/DDK-tagged | +Inquiry |
ALX3-495M | Recombinant Mouse ALX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALX3-1991H | Recombinant Human ALX3 Protein, MYC/DDK-tagged | +Inquiry |
ALX3-510H | Recombinant Human ALX3 protein, GST-tagged | +Inquiry |
ALX3-511H | Recombinant Human ALX3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALX3 Products
Required fields are marked with *
My Review for All ALX3 Products
Required fields are marked with *