Recombinant Human ALYREF Protein(11-250aa), MBP&His-tagged

Cat.No. : ALYREF-9607H
Product Overview : Recombinant Human ALYREF Protein(11-250aa)(Q86V81), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&MBP
Protein Length : 11-250aa
Form : 0.15 M Phosphate buffered saline.
AA Sequence : DIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAY
Storage : Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name ALYREF Aly/REF export factor [ Homo sapiens ]
Official Symbol ALYREF
Synonyms Aly/REF export factor; Ally of AML-1 and LEF-1; ALY; Transcriptional coactivator Aly/REF; BEF; bZIP-enhancing factor BEF; THOC4; bZIP enhancing factor; ALY/REF; THO complex subunit 4; REF; tho4; THO complex 4; Tho4
Gene ID 10189
mRNA Refseq NM_005782
Protein Refseq NP_005773
MIM 604171
UniProt ID Q86V81

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALYREF Products

Required fields are marked with *

My Review for All ALYREF Products

Required fields are marked with *

0
cart-icon