Recombinant Human ALYREF protein, GST-tagged
| Cat.No. : | ALYREF-512H |
| Product Overview : | Human ALYREF full-length ORF (AAH52302.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 54.67 kDa |
| AA Sequence : | MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALYREF Aly/REF export factor [ Homo sapiens ] |
| Official Symbol | ALYREF |
| Synonyms | ALY; BEF; REF; THOC4; ALY/REF |
| Gene ID | 10189 |
| mRNA Refseq | NM_005782.3 |
| Protein Refseq | NP_005773.3 |
| MIM | 604171 |
| UniProt ID | Q86V81 |
| ◆ Recombinant Proteins | ||
| ALYREF-5241C | Recombinant Chicken ALYREF | +Inquiry |
| ALYREF-9606H | Recombinant Human ALYREF Protein(11-250aa), His-tagged | +Inquiry |
| ALYREF-496M | Recombinant Mouse ALYREF Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALYREF-5987Z | Recombinant Zebrafish ALYREF | +Inquiry |
| ALYREF-1114HF | Recombinant Full Length Human ALYREF Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALYREF Products
Required fields are marked with *
My Review for All ALYREF Products
Required fields are marked with *
