Recombinant Human AMACR protein, GST-tagged
| Cat.No. : | AMACR-513H |
| Product Overview : | Human AMACR full-length ORF ( AAH09471, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
| Availability | June 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011] |
| Molecular Mass : | 47.52 kDa |
| AA Sequence : | MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AMACR alpha-methylacyl-CoA racemase [ Homo sapiens ] |
| Official Symbol | AMACR |
| Synonyms | AMACR; alpha-methylacyl-CoA racemase; RACE; 2-methylacyl-CoA racemase; RM; CBAS4; AMACRD; |
| Gene ID | 23600 |
| mRNA Refseq | NM_001167595 |
| Protein Refseq | NP_001161067 |
| MIM | 604489 |
| UniProt ID | Q9UHK6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMACR Products
Required fields are marked with *
My Review for All AMACR Products
Required fields are marked with *
