Recombinant Human AMACR protein, GST-tagged
Cat.No. : | AMACR-513H |
Product Overview : | Human AMACR full-length ORF ( AAH09471, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011] |
Molecular Mass : | 47.52 kDa |
AA Sequence : | MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMACR alpha-methylacyl-CoA racemase [ Homo sapiens ] |
Official Symbol | AMACR |
Synonyms | AMACR; alpha-methylacyl-CoA racemase; RACE; 2-methylacyl-CoA racemase; RM; CBAS4; AMACRD; |
Gene ID | 23600 |
mRNA Refseq | NM_001167595 |
Protein Refseq | NP_001161067 |
MIM | 604489 |
UniProt ID | Q9UHK6 |
◆ Recombinant Proteins | ||
AMACR-312R | Recombinant Rhesus monkey AMACR Protein, His-tagged | +Inquiry |
AMACR-1148HF | Recombinant Full Length Human AMACR Protein, GST-tagged | +Inquiry |
Amacr-1607M | Recombinant Mouse Amacr Protein, Myc/DDK-tagged | +Inquiry |
AMACR-3096C | Recombinant Chicken AMACR | +Inquiry |
AMACR-111H | Recombinant Human AMACR, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMACR-8888HCL | Recombinant Human AMACR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMACR Products
Required fields are marked with *
My Review for All AMACR Products
Required fields are marked with *
0
Inquiry Basket